2.00 Rating by CuteStat

brighthousefarm.co.uk is 1 decade 5 years old. It is a domain having co.uk extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, brighthousefarm.co.uk is SAFE to browse.

PageSpeed Score
86
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

213.229.84.217

Hosted Country:

United Kingdom GB

Location Latitude:

51.5228

Location Longitude:

-0.71986

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 7
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 213.229.84.217)

403 Forbidden

- provocativeescorts.com
Not Applicable $ 8.95

Home -

- escortsofenticement.com
Not Applicable $ 8.95

403 Forbidden

- awakeningtantricenergyspamassage.com
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Mon, 24 Nov 2014 16:10:02 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: close
Server: Apache
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache

Domain Information

Domain Registrar: Nimzo 3, LLC
Registration Date: Sep 8, 2008, 12:00 AM 1 decade 5 years 7 months ago
Last Modified: Oct 24, 2013, 12:00 AM 1 decade 6 months 1 week ago
Domain Status:
Registered until expiry date.

Domain Nameserver Information

Host IP Address Country
ns1.lucid.dnsonly.co.uk 151.236.32.38 United Kingdom United Kingdom
ns2.lucid.dnsonly.co.uk 185.42.221.11 United Kingdom United Kingdom

DNS Record Analysis

Host Type TTL Extra
brighthousefarm.co.uk A 119 IP: 213.229.84.217
brighthousefarm.co.uk NS 119 Target: ns2.lucid.dnsonly.co.uk
brighthousefarm.co.uk NS 119 Target: ns1.lucid.dnsonly.co.uk
brighthousefarm.co.uk SOA 119 MNAME: ns1.lucid.dnsonly.co.uk
RNAME: lucid.m.ingle.co.uk
Serial: 2013102301
Refresh: 120
Retry: 120
Expire: 120
Minimum TTL: 120
brighthousefarm.co.uk MX 119 Target: brighthousefarm.co.uk

Full WHOIS Lookup

Domain name:
brighthousefarm.co.uk

Registrant:
Lucid Entertainment LTD

Registrant type:
UK Individual

Registrant's address:
122 Feering Hill
Feering
Colchester
Essex
CO5 9PY
United Kingdom

Data validation:
Registrant contact details validated by Nominet on 10-Dec-2012

Registrar:
Namesco Limited [Tag = NAMESCO]
URL: http://www.names.co.uk

Relevant dates:
Registered on: 08-Sep-2008
Expiry date: 08-Sep-2015
Last updated: 24-Oct-2013

Registration status:
Registered until expiry date.

Name servers:
ns1.lucid.dnsonly.co.uk
ns2.lucid.dnsonly.co.uk

WHOIS lookup made at 16:10:10 24-Nov-2014

--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2014.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at http://www.nominet.org.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.